HPA027520

VEZF1 antibody from Sigma-Aldrich
DB1, ZNF161
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA027520
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA027520, RRID:AB_10602680
Product name
Anti-VEZF1 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA027520
Antibody type
Polyclonal
Antigen
vascular endothelial zinc finger 1 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
RLWEEAVKARKKEAANLCQTSTAATTPVTLTTPFS
ITSSVSSGTMSNPVTVAAAMSMRSPVNVSSAVNIT
SPMNIGHPVTITSPLSMTSPLTLTTPVNLPTPVTA
PVNIAHPVTITSPMNLPTPMTLAAPLNIAMRPVES
Storage
-20C
Provider Type Product Number
- No reagents -