H00004601-M11

MXI1 antibody from Abnova Corporation
bHLHc11, MAD2, MXD2, MXI

Antibody data

Product number
H00004601-M11
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00004601-M11, RRID:AB_1204710
Product name
MXI1 monoclonal antibody (M11), clone 1B10
Provider product page
Abnova Corporation - H00004601-M11
Antibody type
Monoclonal
Description
Mouse monoclonal antibody raised against a full-length recombinant MXI1.
Antigen sequence
MPSPRLQHSKPPRRLSRAQKHSSGSSNTSTANRRA
HLRLCLERLKVLIPLGPDCTRHTTLGLLNKAKAHI
KKLEEAERKSQHQLENLEREQRFLKWRLEQLQGPQ
EMERIRMDSIGSTISSDRSDSEREEIEVDVESTEF
SHGEVDNISTTSISDIDDHSSLPSIGSDEGYSSAS
VKLSFTS
Isotype
IgG
Antibody clone number
1B10
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -