HPA006790

DRAP1 antibody from Sigma-Aldrich
NC2-alpha
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA006790
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA006790, RRID:AB_1078702
Product name
Anti-DRAP1 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA006790
Antibody type
Polyclonal
Antigen
Dr1-associated corepressor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
RIKKIMQTDEEIGKVAAAVPVIISRALELFLESLL
KKACQVTQSRNAKTMTTSHLKQCIELEQQFDFLKD
LVASVPDMQGDGEDNHMDGDKGARRGRKPGSGGRK
NGGMGTKSKDKKLSGTDSEQEDESEDTDTDGEEET
SQ
Storage
-20C
Provider Type Product Number
- No reagents -