HPA021372

MKS1 antibody from Atlas Antibodies
BBS13, FLJ20345, MKS, POC12
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA021372
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA021372, RRID:AB_1848746
Product name
Anti-MKS1
Provider product page
Atlas Antibodies - HPA021372
Antibody type
Polyclonal
Reactivity
Human, Rat
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
EVPSFLVERMANVRRRRQDRRGMEGGILKSRIVTW
EPSEEFVRNNHVINTPLQTMHIMADLGPYKKLGYK
KYEHVLCTLKVDSNGVITVKPDFTGLKGPYRI
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -