HPA021812

MKS1 antibody from Sigma-Aldrich
BBS13, FLJ20345, MKS, POC12
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA021812
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA021812, RRID:AB_2142654
Product name
Anti-MKS1 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA021812
Antibody type
Polyclonal
Antigen
Meckel syndrome type 1 protein recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
TCTTKSLAMDKVAHFSYPFTFEAFFLHEDESSDAL
PEWPVLYCEVLSLDFWQRYRVEGYGAVVLPATPGS
HTLTVSTWRPVELGTVA
Storage
-20C
Provider Type Product Number
- No reagents -