Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- Western blot [2]
- ELISA [1]
- Immunocytochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00001847-M04 - Provider product page

- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00001847-M04, RRID:AB_509351
- Product name
- DUSP5 monoclonal antibody (M04), clone 2F3
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant DUSP5.
- Antigen sequence
LKEAFDYIKQRRSMVSPNFGFMGQLLQYESEILPS
TPNPQPPSCQGEAAGSSLIGHLQTLSPDMQGAYCT
FPASVLAPVPTHSTVSELSRSPVATATSC- Isotype
- IgG
- Antibody clone number
- 2F3
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references Zinc-finger nuclease knockout of dual-specificity protein phosphatase-5 enhances the myogenic response and autoregulation of cerebral blood flow in FHH.1BN rats.
Fan F, Geurts AM, Pabbidi MR, Smith SV, Harder DR, Jacob H, Roman RJ
PloS one 2014;9(11):e112878
PloS one 2014;9(11):e112878
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- DUSP5 monoclonal antibody (M04), clone 2F3 Western Blot analysis of DUSP5 expression in K-562 ( Cat # L009V1 ).
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Western Blot analysis of DUSP5 expression in transfected 293T cell line by DUSP5 monoclonal antibody (M04), clone 2F3.Lane 1: DUSP5 transfected lysate (Predicted MW: 42.1 KDa).Lane 2: Non-transfected lysate.
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Detection limit for recombinant GST tagged DUSP5 is approximately 1ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Immunofluorescence of monoclonal antibody to DUSP5 on HeLa cell. [antibody concentration 10 ug/ml]
- Validation comment
- Immunofluorescence
- Protocol
- Protocol