Antibody data

Product number
H00001847-M02A
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00001847-M02A, RRID:AB_1204290
Product name
DUSP5 monoclonal antibody (M02A), clone 3D8
Provider product page
Abnova Corporation - H00001847-M02A
Antibody type
Monoclonal
Description
Mouse monoclonal antibody raised against a partial recombinant DUSP5.
Antigen sequence
LKEAFDYIKQRRSMVSPNFGFMGQLLQYESEILPS
TPNPQPPSCQGEAAGSSLIGHLQTLSPDMQGAYCT
FPASVLAPVPTHSTVSELSRSPVATATSC
Isotype
IgG
Antibody clone number
3D8
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -