Explore
Validate
Learn
Western blotAntibody data
- Antibody Data
- Antigen structure
- References [0]
- Comments [0]
- Validations
- Western blot [1]
- Immunohistochemistry [3]
Submit
Validation data
Reference
Comment
Report error
- Product number
- R32356 - Provider product page
- Provider
- NSJ Bioreagents
- Product name
- SMC3 Antibody
- Antibody type
- Polyclonal
- Antigen
- Amino acids ELLESADKFYGVKFRNKVSHIDVITAEMAKDFVEDDTTH of human SMC3 were used as the immunogen for the SMC3 antibody.
- Description
- Antigen affinity
- Reactivity
- Human, Mouse, Rat
- Host
- Rabbit
- Conjugate
- Unconjugated
- Vial size
- 100 µg
- Concentration
- Lyophilized; resuspend with 200 ul for 0.5 mg/ml
- Storage
- After reconstitution, the SMC3 antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.
No comments: Submit comment
Supportive validation
- Submitted by
- NSJ Bioreagents (provider)
- Main image
- Experimental details
- Western blot testing of 1) rat brain, 2) rat liver, 3) rat testis, 4) human HeLa, 5) human A549, 6) human MCF7 and 7) mouse NIH3T3 lysate with SMC3 antibody. Exepcted/observed molecular weight ~141 kDa.
Supportive validation
- Submitted by
- NSJ Bioreagents (provider)
- Main image
- Experimental details
- IHC testing of FFPE human intestinal cancer tissue with SMC3 antibody. HIER: Boil the paraffin sections in pH 6, 10mM citrate buffer for 20 minutes and allow to cool prior to staining.
- Submitted by
- NSJ Bioreagents (provider)
- Main image
- Experimental details
- IHC testing of FFPE mouse intestine with SMC3 antibody. HIER: Boil the paraffin sections in pH 6, 10mM citrate buffer for 20 minutes and allow to cool prior to staining.
- Submitted by
- NSJ Bioreagents (provider)
- Main image
- Experimental details
- IHC testing of FFPE rat kidney with SMC3 antibody. HIER: Boil the paraffin sections in pH 6, 10mM citrate buffer for 20 minutes and allow to cool prior to staining.
