HPA021029

SURF1 antibody from Sigma-Aldrich
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA021029
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA021029, RRID:AB_1857666
Product name
Anti-SURF1 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA021029
Antibody type
Polyclonal
Antigen
Surfeit locus protein 1 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
TWQVQRRKWKLNLIAELESRVLAEPVPLPADPMEL
KNLEYRPVKVRGCFDHSKELYMMPRTMVDPVREAR
EGGLI
Storage
-20C
Provider Type Product Number
- No reagents -