ABIN616920

HTR3A antibody from antibodies-online
5-HT3A, 5-HT3R, HTR3

Antibody data

Product number
ABIN616920
Provider
antibodies-online
Product name
anti-Serotonin Receptor 3A (HTR3A) (Middle Region) antibody
Provider product page
antibodies-online - ABIN616920
Antibody type
Polyclonal
Antigen
The immunogen for anti-Htr3a antibody: synthetic peptide corresponding to a region of Rat
Description
Affinity Purified
Reactivity
Human, Rat
Host
Rabbit
Antigen sequence
PATAIGTPLIGVYFVVCMALLVISLAETIFIVQLV
HKQDL QRPVPDWLRH
Epitope
Middle Region
Vial size
50 μg
Concentration
1mg/mL
Storage
-20°C
Handling
Avoid repeated freeze-thaw cycles.
Provider Type Product Number
- No reagents -