HPA024662

TSPOAP1 antibody from Sigma-Aldrich
BZRAP1, KIAA0612, PRAX-1, RIM-BP1, RIMBP1
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA024662
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA024662, RRID:AB_2066340
Product name
Anti-BZRAP1 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA024662
Antibody type
Polyclonal
Antigen
Peripheral-type benzodiazepine receptor-associated protein 1 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
DPGAMEPWALPTWHSWTPGRGGEPSSAAPSIADTP
PAALQLQELRSEESSKPKGDGSSRPVGGTDPEGAE
ACLPSLGQQASSSGPACQRPEDEEVEAFLKAKLNM
SFGD
Storage
-20C
Provider Type Product Number
- No reagents -