Antibody data
- Antibody Data
- Antigen structure
- References [3]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- HPA029708 - Provider product page
- Provider
- Atlas Antibodies
- Proper citation
- Atlas Antibodies Cat#HPA029708, RRID:AB_10602479
- Product name
- Anti-TFCP2L1
- Antibody type
- Polyclonal
- Reactivity
- Human
- Host
- Rabbit
- Conjugate
- Unconjugated
- Antigen sequence
QVNSAPSPSYNGSPNSFGLGEGNASPTHPVEALPV
GSDHLLPSASIQDAQQWLHRNRFSQ- Isotype
- IgG
- Vial size
- 100 µl
- Storage
- Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Submitted references Temporal activation of LRH‐1 and RAR‐γ in human pluripotent stem cells induces a functional naïve‐like state
Tankyrase inhibition promotes a stable human naïve pluripotent state with improved functionality
RNA Deep Sequencing as a Tool for Selection of Cell Lines for Systematic Subcellular Localization of All Human Proteins
Taei A, Kiani T, Taghizadeh Z, Moradi S, Samadian A, Mollamohammadi S, Sharifi‐Zarchi A, Guenther S, Akhlaghpour A, Asgari Abibeiglou B, Najar‐Asl M, Karamzadeh R, Khalooghi K, Braun T, Hassani S, Baharvand H
EMBO reports 2020;21(10)
EMBO reports 2020;21(10)
Tankyrase inhibition promotes a stable human naïve pluripotent state with improved functionality
Zimmerlin L, Park T, Huo J, Verma K, Pather S, Talbot C, Agarwal J, Steppan D, Zhang Y, Considine M, Guo H, Zhong X, Gutierrez C, Cope L, Canto-Soler M, Friedman A, Baylin S, Zambidis E
Development 2016;143(23):4368-4380
Development 2016;143(23):4368-4380
RNA Deep Sequencing as a Tool for Selection of Cell Lines for Systematic Subcellular Localization of All Human Proteins
Danielsson F, Wiking M, Mahdessian D, Skogs M, Ait Blal H, Hjelmare M, Stadler C, Uhlén M, Lundberg E
Journal of Proteome Research 2012;12(1):299-307
Journal of Proteome Research 2012;12(1):299-307
No comments: Submit comment
No validations: Submit validation data