H00003351-A01

HTR1B antibody from Abnova Corporation
5-HT1B, 5-HT1DB, HTR1D2, S12
No application information provided.

Antibody data

Product number
H00003351-A01
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00003351-A01, RRID:AB_489489
Product name
HTR1B polyclonal antibody (A01)
Provider product page
Abnova Corporation - H00003351-A01
Antibody type
Polyclonal
Description
Mouse polyclonal antibody raised against a partial recombinant HTR1B.
Antigen sequence
MEEPGAQCAPPPPAGSETWVPQANLSSAPSQNCSA
KDYIYQDSISLPWK
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -