HPA028808

HTR1B antibody from Atlas Antibodies
5-HT1B, 5-HT1DB, HTR1D2, S12

Antibody data

Product number
HPA028808
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA028808, RRID:AB_2672782
Product name
Anti-HTR1B
Provider product page
Atlas Antibodies - HPA028808
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
MEEPGAQCAPPPPAGSETWVPQANLSSAPSQNCSA
KDYIYQDS
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -