Explore
Validate
Learn
Western blotAntibody data
- Antibody Data
- Antigen structure
- References [0]
- Comments [0]
- Validations
- Western blot [2]
- Immunocytochemistry [2]
- Immunohistochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- HPA059180 - Provider product page
- Provider
- Atlas Antibodies
- Proper citation
- Atlas Antibodies Cat#HPA059180, RRID:AB_2683940
- Product name
- Anti-NNMT
- Antibody type
- Polyclonal
- Reactivity
- Human
- Host
- Rabbit
- Conjugate
- Unconjugated
- Antigen sequence
GFLVIMDALKSSYYMIGEQKFSSLPLGREAVEAAV
KEAGYTIEWFEVISQSYSSTMANNEGLFSLVARKL
SRP- Isotype
- IgG
- Vial size
- 100 µl
- Storage
- Store at +4°C for short term storage. Long time storage is recommended at -20°C.
No comments: Submit comment
Supportive validation
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Enhanced method
- Orthogonal validation
- Main image
- Experimental details
- Western blot analysis in human cell lines U2OS and SK-MEL-30 using Anti-NNMT antibody. Corresponding NNMT RNA-seq data are presented for the same cell lines. Loading control: Anti-GAPDH.
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10Lane 2: Human cell line RT-4Lane 3: Human cell line U-251MG spLane 4: Human plasma (IgG/HSA depleted)Lane 5: Human liver tissue
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunofluorescent staining of human cell line SiHa shows localization to the Golgi apparatus.
- Sample type
- HUMAN
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunofluorescent staining of human cell line SiHa shows localization to the Golgi apparatus.
- Sample type
- HUMAN
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human liver shows strong cytoplasmic and nuclear positivity in hepatocytes.
- Sample type
- HUMAN
