Antibody data
- Antibody Data
- Antigen structure
- References [2]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN310313 - Provider product page
- Provider
- antibodies-online
- Product name
- anti-Nicotinamide N-Methyltransferase (NNMT) (N-Term) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-NNMT antibody: synthetic peptide directed towards the N terminal of human NNMT
- Description
- Protein A purified
- Reactivity
- Human, Mouse, Rat, Canine, Porcine
- Host
- Rabbit
- Antigen sequence
MESGFTSKDTYLSHFNPRDYLEKYYKFGSRHSAES
QILKH LLKNLFKIFC- Epitope
- N-Term
- Vial size
- 100 μg
- Concentration
- 1mg/mL
- Storage
- -20°C
- Handling
- Avoid repeated freeze-thaw cycles.
Submitted references NNMT promotes epigenetic remodeling in cancer by creating a metabolic methylation sink.
Identification of nicotinamide N-methyltransferase as a novel serum tumor marker for colorectal cancer.
Ulanovskaya OA, Zuhl AM, Cravatt BF
Nature chemical biology 2013 May;9(5):300-6
Nature chemical biology 2013 May;9(5):300-6
Identification of nicotinamide N-methyltransferase as a novel serum tumor marker for colorectal cancer.
Roessler M, Rollinger W, Palme S, Hagmann ML, Berndt P, Engel AM, Schneidinger B, Pfeffer M, Andres H, Karl J, Bodenmüller H, Rüschoff J, Henkel T, Rohr G, Rossol S, Rösch W, Langen H, Zolg W, Tacke M
Clinical cancer research : an official journal of the American Association for Cancer Research 2005 Sep 15;11(18):6550-7
Clinical cancer research : an official journal of the American Association for Cancer Research 2005 Sep 15;11(18):6550-7
No comments: Submit comment
No validations: Submit validation data