Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- Western blot [1]
- Immunohistochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN1107467 - Provider product page
- Provider
- antibodies-online
- Product name
- anti-General Transcription Factor IIF, Polypeptide 2, 30kDa (GTF2F2) (C-Term) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-GTF2F2 antibody: synthetic peptide directed towards the C terminal of human GTF2F2
- Description
- Purified on peptide immunoaffinity column
- Reactivity
- Human, Mouse, Rat, Bovine, Canine, Chicken/Avian, Xenopus, Zebrafish
- Host
- Rabbit
- Antigen sequence
KDLVDITKQPVVYLKEILKEIGVQNVKGIHKNTWE
LKPEYRHYQGEEKSD- Epitope
- C-Term
- Vial size
- 50 μg
- Storage
- Store the lyophised antibody at -20°C for up to one year. Store reconstitued antibody undiluted for one month or in aliquots at -20°C long term.
- Handling
- Avoid repeated freezing and thawing.
Submitted references Genes encoding general initiation factors for RNA polymerase II transcription are dispersed in the human genome.
Heng HH, Xiao H, Shi XM, Greenblatt J, Tsui LC
Human molecular genetics 1994 Jan;3(1):61-4
Human molecular genetics 1994 Jan;3(1):61-4
No comments: Submit comment
Supportive validation
- Submitted by
- antibodies-online (provider)
- Main image
- Experimental details
- Human Liver; WB Suggested Anti-GTF2F2 Antibody Titration: 0.2-1 ug/ml. ELISA Titer: 1:312500. Positive Control: Human Liver; GTF2F2 antibody - C-terminal region (AP42028PU-N) in Human Liver cells using Western Blot
Supportive validation
- Submitted by
- antibodies-online (provider)
- Main image
- Experimental details
- Human kidney; GTF2F2 antibody - C-terminal region (AP42028PU-N) in Human kidney cells using Immunohistochemistry