Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- Western blot [1]
- Immunohistochemistry [2]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN1107468 - Provider product page
- Provider
- antibodies-online
- Product name
- anti-General Transcription Factor IIF, Polypeptide 2, 30kDa (GTF2F2) (Middle Region) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-GTF2F2 antibody: synthetic peptide directed towards the middle region of human GTF2F2
- Description
- Purified on peptide immunoaffinity column
- Reactivity
- Human, Mouse, Rat, Bovine, Canine, Chicken/Avian, Xenopus, Zebrafish
- Host
- Rabbit
- Antigen sequence
IEESSKPVRLSQQLDKVVTTNYKPVANHQYNIEYE
RKKKEDGKRARADKQ- Epitope
- Middle Region
- Vial size
- 50 μg
- Storage
- Store the lyophised antibody at -20°C for up to one year. Store reconstitued antibody undiluted for one month or in aliquots at -20°C long term.
- Handling
- Avoid repeated freezing and thawing.
Submitted references Genes encoding general initiation factors for RNA polymerase II transcription are dispersed in the human genome.
Heng HH, Xiao H, Shi XM, Greenblatt J, Tsui LC
Human molecular genetics 1994 Jan;3(1):61-4
Human molecular genetics 1994 Jan;3(1):61-4
No comments: Submit comment
Supportive validation
- Submitted by
- antibodies-online (provider)
- Main image
- Experimental details
- Human HepG2; WB Suggested Anti-GTF2F2 Antibody Titration: 0.2-1 ug/ml. ELISA Titer: 1:1562500. Positive Control: HepG2 cell lysate; GTF2F2 antibody - middle region (AP42032PU-N) in Human HepG2 cells using Western Blot
Supportive validation
- Submitted by
- antibodies-online (provider)
- Main image
- Experimental details
- Human Brain; Rabbit Anti-GTF2F2 Antibody. Paraffin Embedded Tissue: Human Brain. Cellular Data: Neural Cells. Antibody Concentration: 4.0-8.0 ug/ml. Magnification: 400X; GTF2F2 antibody - middle region (AP42032PU-N) in Human Brain cells using Immunohistochemistry
- Submitted by
- antibodies-online (provider)
- Main image
- Experimental details
- Human Spermatophore; Rabbit Anti-GTF2F2 Antibody. Paraffin Embedded Tissue: Human Spermatophore. Cellular Data: Epithelial cells. Antibody Concentration: 4.0-8.0 ug/ml. Magnification: 400X; GTF2F2 antibody - middle region (AP42032PU-N) in Human Spermatophore cells using Immunohistochemistry