HPA006912

GTF2F2 antibody from Sigma-Aldrich
BTF4, RAP30, TFIIF
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA006912
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA006912, RRID:AB_1080256
Product name
Anti-GTF2F2 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA006912
Antibody type
Polyclonal
Antigen
Transcription initiation factor IIF subunit beta recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
YKPVANHQYNIEYERKKKEDGKRARADKQHVLDML
FSAFEKHQYYNLKDLVDITKQPVVYLKEILKEIGV
QNVKGIHKNTWELKPEYRHYQGEEK
Storage
-20C
Provider Type Product Number
- No reagents -