ABIN183135
antibody from antibodies-online
Targeting: KCNAB1
AKR6A3, hKvb3, hKvBeta3, KCNA1B, Kvb1.3
Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- Western blot [1]
- Immunohistochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN183135 - Provider product page

- Provider
- antibodies-online
- Product name
- anti-Potassium Voltage-Gated Channel, Shaker-Related Subfamily, beta Member 1 (KCNAB1) (C-Term) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-KCNAB1 antibody: synthetic peptide directed towards the C terminal of human KCNAB1
- Description
- Affinity Purified
- Reactivity
- Human, Mouse, Rat, Bovine, Canine, Chicken/Avian, Porcine, Rabbit, Zebrafish
- Host
- Rabbit
- Antigen sequence
VPESSRASLKCYQWLKERIVSEEGRKQQNKLKDLS
PIAER LGCTLPQLAV- Epitope
- C-Term
- Vial size
- 50 μg
- Concentration
- 1mg/mL
- Storage
- -20°C
- Handling
- Avoid repeated freeze-thaw cycles.
Submitted references Statistical analysis of the 5' untranslated region of human mRNA using "Oligo-Capped" cDNA libraries.
Suzuki Y, Ishihara D, Sasaki M, Nakagawa H, Hata H, Tsunoda T, Watanabe M, Komatsu T, Ota T, Isogai T, Suyama A, Sugano S
Genomics 2000 Mar 15;64(3):286-97
Genomics 2000 Mar 15;64(3):286-97
No comments: Submit comment
Supportive validation
- Submitted by
- antibodies-online (provider)
- Main image

- Experimental details
- WB Suggested Anti-KCNAB1 Antibody Titration: 0.2-1 μg/mL ELISA Titer: 1:.12500 Positive Control: Human kidney
Supportive validation
- Submitted by
- antibodies-online (provider)
- Main image

- Experimental details
- mouse PFC