HPA016440

HSF5 antibody from MilliporeSigma / Merck KGaA
FLJ40311
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA016440
Provider
MilliporeSigma / Merck KGaA
Proper citation
Sigma-Aldrich Cat#HPA016440, RRID:AB_1851142
Product name
Anti-HSF5 antibody produced in rabbit
Provider product page
MilliporeSigma / Merck KGaA - HPA016440
Antibody type
Polyclonal
Antigen
Heat shock factor protein 5 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
HGPVAVGQFHRSFRRDSLSPYSCVSTPSHDHSTYP
LKGLDRTPVPHRIWQNSLGMHPGQVETSPTFSDKG
VPFPVLQRFPTEVTYTLQPSTTSVHVQQGPQTMVS
SSQKYSNYTPSAQYSQAYYPTAVLQCCSPTHMDAL
SSCV
Storage
-20C
Provider Type Product Number
- No reagents -