HPA006961

ZNF135 antibody from MilliporeSigma / Merck KGaA
pHZ-17, ZNF61, ZNF78L1
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA006961
Provider
MilliporeSigma / Merck KGaA
Proper citation
Sigma-Aldrich Cat#HPA006961, RRID:AB_1080670
Product name
Anti-ZNF135 antibody produced in rabbit
Provider product page
MilliporeSigma / Merck KGaA - HPA006961
Antibody type
Polyclonal
Antigen
Zinc finger protein 135 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
FLWDGLWYCRGEDTEGHWEWSCESLESLAVPVAFT
PVKTPVLEQWQRNGFGENISLNPDLPHQPMTPERQ
SPHTWGTRGKREKPDLNVLQKTCVKEKPYKCQECG
KAFSHSSALI
Storage
-20C
Provider Type Product Number
- No reagents -