HPA026645

VEPH1 antibody from Sigma-Aldrich
FLJ12604, KIAA1692
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA026645
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA026645, RRID:AB_1858741
Product name
Anti-VEPH1 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA026645
Antibody type
Polyclonal
Antigen
Ventricular zone-expressed PH domain-containing protein homolog 1 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
RAGDLFSLDDSEIEDSLTEALEQIKIISSSSDYQT
NNNDQAVVEICITRITTAIRETESIEKHAKALVGL
WDSCLEHNLRPFGKDEDTPHAKIASDIMSCILQNY
NRPPVMALAIPIAVKFLHRGNKELCRNMS
Storage
-20C
Provider Type Product Number
- No reagents -