HPA002549

APOA4 antibody from Sigma-Aldrich
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA002549
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA002549, RRID:AB_1078177
Product name
Anti-APOA4 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA002549
Antibody type
Polyclonal
Antigen
Apolipoprotein A-IV precursor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
DKLGEVNTYAGDLQKKLVPFATELHERLAKDSEKL
KEEIGKELEELRARLLPHANEVSQKIGDNLRELQQ
RLEPYADQLRTQVNTQAEQLRRQLTPYAQRMERVL
RENADSLQASLRPHADELKAKIDQNVEELKGRLTP
YADEFKVK
Storage
-20C
Provider Type Product Number
- No reagents -