HPA021467

HSD17B14 antibody from Atlas Antibodies
DHRS10, retSDR3, SDR47C1
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA021467
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA021467, RRID:AB_1847652
Product name
Anti-HSD17B14
Provider product page
Atlas Antibodies - HPA021467
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
ATGTRYAGKVVVVTGGGRGIGAGIVRAFVNSGARV
VICDKDESGGRALEQELPGAVFILCDVTQEDDVKT
LVSETIR
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -