HPA021467

HSD17B14 antibody from Sigma-Aldrich
DHRS10, retSDR3, SDR47C1
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA021467
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA021467, RRID:AB_1847652
Product name
Anti-HSD17B14 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA021467
Antibody type
Polyclonal
Antigen
17-beta-hydroxysteroid dehydrogenase 14 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
ATGTRYAGKVVVVTGGGRGIGAGIVRAFVNSGARV
VICDKDESGGRALEQELPGAVFILCDVTQEDDVKT
LVSETIR
Storage
-20C
Provider Type Product Number
- No reagents -