Antibody data
- Antibody Data
- Antigen structure
- References [0]
- Comments [0]
- Validations
- Western blot [2]
- ELISA [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00006474-M01 - Provider product page

- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00006474-M01, RRID:AB_509079
- Product name
- SHOX2 monoclonal antibody (M01), clone 1D1
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant SHOX2.
- Antigen sequence
SPELKDRKDDAKGMEDEGQTKIKQRRSRTNFTLEQ
LNELERLFDETHYPDAFMREELSQRLGLSEARVQV
WFQNRRAKCRKQENQLHK- Isotype
- IgG
- Antibody clone number
- 1D1
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- SHOX2 monoclonal antibody (M01), clone 1D1 Western Blot analysis of SHOX2 expression in PC-12 ( Cat # L012V1 ).
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Western Blot analysis of SHOX2 expression in transfected 293T cell line by SHOX2 monoclonal antibody (M01), clone 1D1.Lane 1: SHOX2 transfected lysate(37.6 KDa).Lane 2: Non-transfected lysate.
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Detection limit for recombinant GST tagged SHOX2 is 1 ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol