HPA014357

ZDHHC6 antibody from Sigma-Aldrich
FLJ21952, ZNF376
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA014357
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA014357, RRID:AB_2304658
Product name
Anti-ZDHHC6 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA014357
Antibody type
Polyclonal
Antigen
Palmitoyltransferase ZDHHC6, probable recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
QLYHRLSFGWNTVKIDMSAARRDPLPIVPFGLAAF
Storage
-20C
Provider Type Product Number
- No reagents -