HPA014357

ZDHHC6 antibody from Atlas Antibodies
FLJ21952, ZNF376
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA014357
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA014357, RRID:AB_2304658
Product name
Anti-ZDHHC6
Provider product page
Atlas Antibodies - HPA014357
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
QLYHRLSFGWNTVKIDMSAARRDPLPIVPFGLAAF
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -