HPA011013

ZNF782 antibody from Atlas Antibodies
FLJ16636
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA011013
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA011013, RRID:AB_1080758
Product name
Anti-ZNF782
Provider product page
Atlas Antibodies - HPA011013
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
QSTFSVHQKVHIRAKPYEYNECGKSCSMNSHLIWP
QKSHTGEKPYECPECGKAFSEKSRLRKHQRTHTGE
KPYKCDGCDKAFSAKSGLRIHQRTHTGEKPFECHE
CGKSFNYKS
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -