HPA011013

ZNF782 antibody from Sigma-Aldrich
FLJ16636
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA011013
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA011013, RRID:AB_1080758
Product name
Anti-ZNF782 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA011013
Antibody type
Polyclonal
Antigen
Zinc finger protein 782 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
QSTFSVHQKVHIRAKPYEYNECGKSCSMNSHLIWP
QKSHTGEKPYECPECGKAFSEKSRLRKHQRTHTGE
KPYKCDGCDKAFSAKSGLRIHQRTHTGEKPFECHE
CGKSFNYKS
Storage
-20C
Provider Type Product Number
- No reagents -