HPA024629

KLF17 antibody from Atlas Antibodies
FLJ40160, Zfp393, ZNF393
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA024629
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA024629, RRID:AB_1668927
Product name
Anti-KLF17
Provider product page
Atlas Antibodies - HPA024629
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
TVPSTEAQAVLPSMAQMLPPQDAHDLGMPPAESQS
LLVLGSQDSLVSQPDSQEGPFLPEQPGPAPQTVEK
NSRPQEGTG
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -