PAB21722

KLF17 antibody from Abnova Corporation
FLJ40160, Zfp393, ZNF393

Antibody data

Product number
PAB21722
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#PAB21722, RRID:AB_10963846
Product name
KLF17 polyclonal antibody
Provider product page
Abnova Corporation - PAB21722
Antibody type
Polyclonal
Description
Rabbit polyclonal antibody raised against recombinant KLF17.
Antigen sequence
TVPSTEAQAVLPSMAQMLPPQDAHDLGMPPAESQS
LLVLGSQDSLVSQPDSQEGPFLPEQPGPAPQTVEK
NSRPQEGTG
Isotype
IgG
Storage
Store at 4°C. For long term storage store at -20°C.Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -