HPA024629

KLF17 antibody from Sigma-Aldrich
FLJ40160, Zfp393, ZNF393
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA024629
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA024629, RRID:AB_1848933
Product name
Anti-KLF17 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA024629
Antibody type
Polyclonal
Antigen
Krueppel-like factor 17 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
TVPSTEAQAVLPSMAQMLPPQDAHDLGMPPAESQS
LLVLGSQDSLVSQPDSQEGPFLPEQPGPAPQTVEK
NSRPQEGTG
Storage
-20C
Provider Type Product Number
- No reagents -