H00080345-B01P

ZSCAN16 antibody from Abnova Corporation
dJ265C24.3, FLJ22191, ZNF392, ZNF435

Antibody data

Product number
H00080345-B01P
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00080345-B01P, RRID:AB_1582105
Product name
ZSCAN16 purified MaxPab mouse polyclonal antibody (B01P)
Provider product page
Abnova Corporation - H00080345-B01P
Antibody type
Polyclonal
Description
Mouse polyclonal antibody raised against a full-length human ZSCAN16 protein.
Antigen sequence
MTTALEPEDQKGLLIIKAEDHYWGQDSSSQKCSPH
RRELYRQHFRKLCYQDAPGPREALTQLWELCRQWL
RPECHTKEQILDLLVLEQFLSILPKDLQAWVRAHH
PETGEEAVTVLEDLERELDEPGKQVPGNSERRDIL
MDKLAPLGRPYESLTVQLHPKKTQLEQEAGKPQRN
GDKTRTKNEELFQKEDMPKDKEFLGEINDRLNKDT
PQHPKSKDIIENEGRSEWQQRERRRYKCDECGKSF
SHSSDLSKHRRTHTGEKPYKCDECGKAFIQRSHLI
GHHRVHTGVKPYKCKECGKDFSGRTGLIQHQRIHT
GEKPYECDECGRPFRVSSALIRHQRIHTANKLY
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -