Antibody data
- Antibody Data
- Antigen structure
- References [0]
- Comments [0]
- Validations
- Western blot [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN1449811 - Provider product page
- Provider
- antibodies-online
- Product name
- anti-Zinc Finger and SCAN Domain Containing 16 (ZSCAN16) (N-Term) antibody
- Antibody type
- Polyclonal
- Antigen
- A synthetic peptide directed towards the N-terminal region of human ZSCAN16
- Description
- Purified using Protein A affinity column
- Reactivity
- Human, Bovine, Canine
- Host
- Rabbit
- Antigen sequence
MTTALEPEDQKGLLIIKAEDHYWGQDSSSQKCSPH
RRELYRQHFRKLCYQ- Epitope
- N-Term
- Vial size
- 0.1 mg
- Concentration
- 1.0 mg/mL
- Storage
- Store lyophilized at 2-8°C or at -20°C long term. After reconstitution store the antibody undiluted at 2-8°C for up to one month or in aliquots at -20°C long term.
- Handling
- Avoid repeated freezing and thawing.
No comments: Submit comment
Supportive validation
- Submitted by
- antibodies-online (provider)
- Main image
- Experimental details
- Transfected 293T; WB Suggested Anti-ZSCAN16 Antibody Titration: 0.625ug/ml. ELISA Titer: 1:62500. Positive Control: Transfected 293T; ZSCAN16 antibody - N-terminal region (AP42666PU-N) in Transfected 293T cells using Western Blot