AV36053

ZSCAN16 antibody from MilliporeSigma / Merck KGaA
dJ265C24.3, FLJ22191, ZNF392, ZNF435
No application information provided.

Antibody data

Product number
AV36053
Provider
MilliporeSigma / Merck KGaA
Proper citation
Sigma-Aldrich Cat#AV36053, RRID:AB_1859264
Product name
Anti-ZNF435 antibody produced in rabbit
Provider product page
MilliporeSigma / Merck KGaA - AV36053
Antibody type
Polyclonal
Antigen
synthetic peptide corresponding to a region of human ZNF435 with an internal ID of P07363
Description
IgG fraction of antiserum
Reactivity
Human
Antigen sequence
RTKNEELFQKEDMPKDKEFLGEINDRLNKDTPQHP
KSKDIIENEGRSEWQ
Storage
-20C
Provider Type Product Number
- No reagents -