HPA007290

ZSCAN16 antibody from Sigma-Aldrich
dJ265C24.3, FLJ22191, ZNF392, ZNF435
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA007290
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA007290, RRID:AB_1080721
Product name
Anti-ZNF435 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA007290
Antibody type
Polyclonal
Antigen
Zinc finger and SCAN domain-containing protein 16 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
DLSKHRRTHTGEKPYKCDECGKAFIQRSHLIGHHR
VHTGVKPYKCKECGKDFSGRTGLIQHQRIHTGEKP
YECDECGR
Storage
-20C
Provider Type Product Number
- No reagents -