Antibody data
- Antibody Data
- Antigen structure
- References [0]
- Comments [0]
- Validations
- Western blot [3]
- ELISA [1]
- Immunocytochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00005889-M01 - Provider product page

- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00005889-M01, RRID:AB_425645
- Product name
- RAD51C monoclonal antibody (M01), clone 3F3-5C6
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a full length recombinant RAD51C.
- Antigen sequence
MRGKTFRFEMQRDLVSFPLSPAVRVKLVSAGFQTA
EELLEVKPSELSKEVGISKAEALETLQIIRRECLT
NKPRYAGTSESHKKCTALELLEQEHTQGFIITFCS
ALDDILGGGVPLMKTTEICGAPGVGKTQL- Isotype
- IgG
- Antibody clone number
- 3F3-5C6
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- RAD51C monoclonal antibody (M01), clone 3F3-5C6 Western Blot analysis of RAD51C expression in HeLa ( Cat # L013V1 ).
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- RAD51C monoclonal antibody (M01), clone 3F3-5C6. Western Blot analysis of RAD51C expression in 293 ( Cat # L026V1 ).
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Western Blot analysis of RAD51C expression in transfected 293T cell line by RAD51C monoclonal antibody (M01), clone 3F3-5C6.Lane 1: RAD51C transfected lysate(42.2 KDa).Lane 2: Non-transfected lysate.
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Detection limit for recombinant GST tagged RAD51C is approximately 0.1ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Immunofluorescence of monoclonal antibody to RAD51C on HeLa cell. [antibody concentration 10 ug/ml]
- Validation comment
- Immunofluorescence
- Protocol
- Protocol