Antibody data

Product number
H00003792-M01
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00003792-M01, RRID:AB_1204564
Product name
KEL monoclonal antibody (M01), clone 4B10
Provider product page
Abnova Corporation - H00003792-M01
Antibody type
Monoclonal
Description
Mouse monoclonal antibody raised against a partial recombinant KEL.
Antigen sequence
LENAADVGGLAIALQAYSKRLLRHHGETVLPSLDL
SPQQIFFRSYAQVMCRKPSPQDSHDTHSPPHLRVH
GPLSSTPAFARYFRCARGALLNPSSRCQLW
Isotype
IgG
Antibody clone number
4B10
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -