HPA019263

PPM1E antibody from Sigma-Aldrich
CaMKP-N, KIAA1072, POPX1, PP2CH
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA019263
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA019263, RRID:AB_1855624
Product name
Anti-PPM1E antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA019263
Antibody type
Polyclonal
Antigen
Protein phosphatase 1E recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
TVIVVFLRDMNKAVNVSEESDWTENSFQGGQEDGG
DDKENHGECKRPWPQHQCSAPADLGYDGRVDSFTD
RTSLSPGSQINVLE
Storage
-20C
Provider Type Product Number
- No reagents -