HPA018462

PPM1E antibody from Atlas Antibodies
CaMKP-N, KIAA1072, POPX1, PP2CH
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA018462
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA018462, RRID:AB_1669642
Product name
Anti-PPM1E
Provider product page
Atlas Antibodies - HPA018462
Antibody type
Polyclonal
Description
Affinity purified using the PrEST antigen as affinity ligand
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
EVEGESLDLCLQQLYKYNCPSFLAAALARATSDEV
LQSDLSAHYIPKETDGTEGTVEIETVKLARSVFSK
LHEI
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -