HPA027147

ERI3 antibody from Sigma-Aldrich
FLJ22943, PINT1, PRNPIP
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA027147
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA027147, RRID:AB_1855725
Product name
Anti-ERI3 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA027147
Antibody type
Polyclonal
Antigen
Prion protein-interacting protein recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
FCSISTRKLAAHGFGASMAAMVSFPPQRYHYFLVL
DFEATCDKPQIHPQEIIEFPILKLNGRTMEIESTF
HMYV
Storage
-20C
Provider Type Product Number
- No reagents -