Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- ELISA [1]
- Immunoprecipitation [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00003026-M01 - Provider product page

- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00003026-M01, RRID:AB_606353
- Product name
- HABP2 monoclonal antibody (M01), clone 1H4
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant HABP2.
- Antigen sequence
GNKCQKVQNTCKDNPCGRGQCLITQSPPYYRCVCK
HPYTGPSCSQVVPVCRPNPCQNGATCSRHKRRSKF
TCACPDQFKGKFCEIGSDDCYVGDGYSYRG- Isotype
- IgG
- Antibody clone number
- 1H4
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references Variation in hyaluronan-binding protein 2 (HABP2) promoter region is associated with unexplained female infertility.
Altmäe S, Kallak TK, Fridén B, Stavreus-Evers A
Reproductive sciences (Thousand Oaks, Calif.) 2011 May;18(5):485-92
Reproductive sciences (Thousand Oaks, Calif.) 2011 May;18(5):485-92
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Detection limit for recombinant GST tagged HABP2 is approximately 1ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Immunoprecipitation of HABP2 transfected lysate using anti-HABP2 monoclonal antibody and Protein A Magnetic Bead (U0007), and immunoblotted with HABP2 MaxPab rabbit polyclonal antibody.
- Validation comment
- Immunoprecipitation
- Protocol
- Protocol