HPA019518

HABP2 antibody from Sigma-Aldrich
FSAP, HABP, HGFAL, PHBP
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA019518
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA019518, RRID:AB_1850467
Product name
Anti-HABP2 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA019518
Antibody type
Polyclonal
Antigen
Hyaluronan-binding protein 2 precursor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
GHCALESKYVKTVCLPDGSFPSGSECHISGWGVTE
TGKGSRQLLDAKVKLIANTLCNSRQLYDHMIDDSM
ICAGNLQKPGQDTCQGDSGGPLTCEKDGTYYVYGI
Storage
-20C
Provider Type Product Number
- No reagents -