HPA023826

IBTK antibody from Sigma-Aldrich
BTBD26, BTKI, DKFZP564B116
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA023826
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA023826, RRID:AB_1851378
Product name
Anti-IBTK antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA023826
Antibody type
Polyclonal
Antigen
Inhibitor of Bruton tyrosine kinase recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
LKEICEVALTEKLTLKNAAMLLEFAAMYSAKQLKL
SCLQFIGLNMAALLEARSLDVLSDGVLKDLSEFYR
KMIPAMDRRVITPYQDGPDISYLEVEDGDIFLKEE
INMEQNHSETMFKKAK
Storage
-20C
Provider Type Product Number
- No reagents -