Antibody data
- Antibody Data
- Antigen structure
- References [0]
- Comments [0]
- Validations
- Western blot [2]
- ELISA [1]
- Immunocytochemistry [1]
- Immunoprecipitation [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00002512-M16 - Provider product page

- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00002512-M16, RRID:AB_10716328
- Product name
- FTL monoclonal antibody (M16), clone X1
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a full length recombinant FTL.
- Antigen sequence
MSSQIRQNYSTDVEAAVNSLVNLYLQASYTYLSLG
FYFDRDDVALEGVSHFFRELAEEKREGYERLLKMQ
NQRGGRALFQDIKKPAEDEWGKTPDAMKAAMALEK
KLNQALLDLHALGSARTDPHLCDFLETHFLDEEVK
LIKKMGDHLTNLHRLGGPEAGLGEYLFERLTLKHD- Isotype
- IgG
- Antibody clone number
- X1
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- FTL monoclonal antibody (M16), clone X1 Western Blot analysis of FTL expression in K-562 ( Cat # L009V1 ).
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Western Blot analysis of FTL expression in transfected 293T cell line by FTL monoclonal antibody (M16), clone X1.Lane 1: FTL transfected lysate(20 KDa).Lane 2: Non-transfected lysate.
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Detection limit for recombinant GST tagged FTL is approximately 0.03ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Immunofluorescence of monoclonal antibody to FTL on HeLa cell. [antibody concentration 10 ug/ml]
- Validation comment
- Immunofluorescence
- Protocol
- Protocol
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Immunoprecipitation of FTL transfected lysate using anti-FTL monoclonal antibody and Protein A Magnetic Bead (U0007), and immunoblotted with FTL MaxPab rabbit polyclonal antibody.
- Validation comment
- Immunoprecipitation
- Protocol
- Protocol