Antibody data
- Antibody Data
- Antigen structure
- References [2]
- Comments [0]
- Validations
- Western blot [1]
- Immunohistochemistry [2]
Submit
Validation data
Reference
Comment
Report error
- Product number
- HPA023923 - Provider product page
- Provider
- Atlas Antibodies
- Proper citation
- Atlas Antibodies Cat#HPA023923, RRID:AB_1855783
- Product name
- Anti-PRR11
- Antibody type
- Polyclonal
- Reactivity
- Human
- Host
- Rabbit
- Conjugate
- Unconjugated
- Antigen sequence
LAPVLLRKPSLAKALQAGPLKKDGPMQITVKDLLT
VKLKKTQSLDEKRKLIPSPKARNPLVTVSDLQHVT
LKPNSKVLSTR- Isotype
- IgG
- Vial size
- 100 µl
- Storage
- Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Submitted references PRR11 Is a Prognostic Marker and Potential Oncogene in Patients with Gastric Cancer.
The prognostic potential and oncogenic effects of PRR11 expression in hilar cholangiocarcinoma
Song Z, Liu W, Xiao Y, Zhang M, Luo Y, Yuan W, Xu Y, Yu G, Hu Y
PloS one 2015;10(8):e0128943
PloS one 2015;10(8):e0128943
The prognostic potential and oncogenic effects of PRR11 expression in hilar cholangiocarcinoma
Chen Y, Cha Z, Fang W, Qian B, Yu W, Li W, Yu G, Gao Y
Oncotarget 2015 August;6(24):20419-20433
Oncotarget 2015 August;6(24):20419-20433
No comments: Submit comment
Enhanced validation
- Submitted by
- Atlas Antibodies (provider)
- Enhanced method
- Orthogonal validation
- Main image
- Experimental details
- Western blot analysis in human cell lines U2OS and SK-MEL-30 using Anti-PRR11 antibody. Corresponding PRR11 RNA-seq data are presented for the same cell lines. Loading control: Anti-COX4I1.
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human nasopharynx shows strong cytoplasmic positivity in respiratory epithelial cells.
- Sample type
- HUMAN
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human nasopharynx shows strong cytoplasmic positivity in respiratory epithelial cells.
- Sample type
- HUMAN