HPA023923

PRR11 antibody from Sigma-Aldrich
FLJ11029
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA023923
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA023923, RRID:AB_1855783
Product name
Anti-PRR11 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA023923
Antibody type
Polyclonal
Antigen
Proline-rich protein 11 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
LAPVLLRKPSLAKALQAGPLKKDGPMQITVKDLLT
VKLKKTQSLDEKRKLIPSPKARNPLVTVSDLQHVT
LKPNSKVLSTR
Storage
-20C
Provider Type Product Number
- No reagents -