HPA021134

TMEM53 antibody from Sigma-Aldrich
FLJ22353, NET4
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA021134
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA021134, RRID:AB_2205162
Product name
Anti-TMEM53 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA021134
Antibody type
Polyclonal
Antigen
Transmembrane protein 53 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
FHTHFYDRLQDAGSRWPELYLYSRADEVVLARDIE
RMVEARLARRVLARSVDFVSSAHVSHLRDYPTYYT
SLCVDFMRNCVRC
Storage
-20C
Provider Type Product Number
- No reagents -